Package: adobeanalyticsr 0.5.1

adobeanalyticsr: R Client for 'Adobe Analytics' API 2.0

Connect to the 'Adobe Analytics' API v2.0 <https://github.com/AdobeDocs/analytics-2.0-apis> which powers 'Analysis Workspace'. The package was developed with the analyst in mind, and it will continue to be developed with the guiding principles of iterative, repeatable, timely analysis.

Authors:Ben Woodard [aut, cre], Tim Wilson [aut, ctb], Charles Gallagher [ctb], Mark Edmondson [ctb]

adobeanalyticsr_0.5.1.tar.gz
adobeanalyticsr_0.5.1.zip(r-4.7-any)adobeanalyticsr_0.5.1.zip(r-4.6-any)adobeanalyticsr_0.5.1.zip(r-4.5-any)
adobeanalyticsr_0.5.1.tgz(r-4.6-any)adobeanalyticsr_0.5.1.tgz(r-4.5-any)
adobeanalyticsr_0.5.1.tar.gz(r-4.7-any)adobeanalyticsr_0.5.1.tar.gz(r-4.6-any)
adobeanalyticsr_0.5.1.tgz(r-4.6-emscripten)
manual.pdf |manual.html
DESCRIPTION |NEWS
card.svg |card.png
adobeanalyticsr/json (API)

# Install 'adobeanalyticsr' in R:
install.packages('adobeanalyticsr', repos = c('https://benrwoodard.r-universe.dev', 'https://cloud.r-project.org'))

Bug tracker:https://github.com/benrwoodard/adobeanalyticsr/issues

Pkgdown/docs site:https://adobeanalyticsr.com

Datasets:
  • seg_verbs - Verbs available in segment rules.

On CRAN:

Conda:

7.12 score 19 stars 50 scripts 580 downloads 43 exports 48 dependencies

Last updated from:af719d7db9. Checks:9 OK. Indexed: yes.

TargetResultTimeFilesSyslog
linux-devel-x86_64OK202
source / vignettesOK219
linux-release-x86_64OK158
macos-release-arm64OK106
macos-oldrel-arm64OK141
windows-develOK101
windows-releaseOK95
windows-oldrelOK105
wasm-releaseOK136

Exports:auth_jwtauth_oauthauth_s2saw_anomaly_reportaw_authaw_auth_nameaw_auth_pathaw_auth_withaw_freeform_tableaw_get_calculatedmetricsaw_get_dimensionsaw_get_metricsaw_get_project_configaw_get_projectsaw_get_reportsuitesaw_get_segmentsaw_get_tagsaw_segment_tableaw_tokenaw_workspace_reportcm_buildcm_copycm_deletecm_formulacm_functioncm_updatecm_valget_cm_functionsget_meget_usage_logsget_usersproj_buildproj_updateseg_buildseg_conseg_copyseg_deleteseg_ruleseg_seqseg_thenseg_updateseg_valtags_add

Dependencies:askpassassertthatcachemclicpp11crayoncurldplyrfarverfastmapgenericsggplot2gluegtablehmshttrhttr2isobandjosejsonlitelabelinglifecyclelubridatemagrittrmemoisemimeopensslpillarpkgconfigprettyunitsprogresspurrrR6RColorBrewerrlangS7scalesstringistringrsystibbletidyrtidyselecttimechangeutf8vctrsviridisLitewithr

Analysis Workflows And Calculated Metrics
A little housekeeping | Setup | Retrieve multiple calculated metrics | Retrieving a single calculated metric | Calculated metric management functions | Get all functions | Create a calculated metric | Create a function object | Create a formula object | Create a calculated metric object | Validate a calculated metric object | Adding a segment filter | Update a calculated metric | Copy a Calculated Metric | Delete calculated metrics | Conclusion

Last update: 2025-01-16
Started: 2023-10-24

Getting Started
Basic Setup | Understanding AW_COMPANY_ID and AW_REPORTSUITE_ID | Load the Package and Authenticate | Get Available Dimensions, Metrics, and Segments | Get Available Dimensions | Get Available Metrics | Get Available Segments | Freeform Table Data Pull | Single Dimension, Single Metric | Single Dimension, Multiple Metrics | Trending Metrics Over Time | Multiple Dimensions, Multiple Metrics | Consider Multiple Dimensions in Analysis Workspace | Multiple Dimensions with aw_freeform_table()

Last update: 2021-12-29
Started: 2021-02-22

Readme and manuals

Help Manual

Help pageTopics
Anomaly Reportaw_anomaly_report
Generate an Access Token for the Adobe Analytics v2.0 APIauth_jwt auth_oauth auth_s2s aw_auth
Set authorization optionsaw_auth_name aw_auth_path aw_auth_with
Get a freeform tableaw_freeform_table
Get a list of calculated metrics.aw_get_calculatedmetrics
Get list of dimensionsaw_get_dimensions
Get list of metricsaw_get_metrics
Pull a project configurationaw_get_project_config
Pull a list of projectsaw_get_projects
Get list of report suitesaw_get_reportsuites
Get a list of segmentsaw_get_segments
Get a list of tagsaw_get_tags
Get a segment-row freeform tableaw_segment_table
OAuth2 Token for Adobe Analytics (deprecated)aw_token
Use a prebuilt json query to pull a ranked reportaw_workspace_report
Build a Calculated Metriccm_build
Copy a Calculated Metriccm_copy
Delete A Calculated Metric Functioncm_delete
Create A Calculated Metric Formulacm_formula
Create A Calculated Metric Functioncm_function
Update Calculated Metric Functionscm_update
Validate the definition of a Calculated Metriccm_val
Get Calculated Metric Functionsget_cm_functions
Get Company Idsget_me
Get a list of user usageget_usage_logs
Get list of usersget_users
Create a project in Adobeproj_build
Edit a project in Adobeproj_update
Build the Segment in Adobe Analyticsseg_build
Create the segment containerseg_con
Copy a segment in Adobe Analyticsseg_copy
Delete A Segmentseg_delete
Create the segment ruleseg_rule
Create the segment sequence containerseg_seq
Create the segment sequence then objectseg_then
Update A Segmentseg_update
Validate a segmentseg_val
Verbs available in segment rules.seg_verbs
Add a tag to a componenttags_add